PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004492478.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 316aa    MW: 36183.2 Da    PI: 6.379
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004492478.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65e-3273126255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     prlrWtp+LH rF++av++LGG+e+AtPk +l+lm++kgL+++hvkSHLQ+YR+
  XP_004492478.1  73 PRLRWTPDLHLRFIHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRS 126
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.4E-2969127IPR009057Homeodomain-like
PROSITE profilePS5129412.47569129IPR017930Myb domain
TIGRFAMsTIGR015575.8E-2373128IPR006447Myb domain, plants
SuperFamilySSF466892.51E-1473127IPR009057Homeodomain-like
PfamPF002498.5E-1074125IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MEDMREEKTY GSECSKTSVS NEVDGCEISE ENHEDEESKQ NNINEGLSSS NSTIEENNEK  60
KSSVRPYVRS KFPRLRWTPD LHLRFIHAVQ RLGGQERATP KLVLQLMNIK GLSIAHVKSH  120
LQMYRSKKVV DTNQDNGDKN VYNLSQLPML QGYTPNQSSS YRCGYEPIMM ERSNNHMVNM  180
DHSIFQVDSS HFREQSSRSK VHEPNDNFLS FCGHDLQDHP RAQDLMLKDN LLANQVEPNT  240
LKRKASDVEV DLDLSLKLNS RNYQGNIEEH EVDSKLSLSL YSQSSSSYLG SKMKEKDVSK  300
EQGKIRGNNI VLDLTI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004492478.10.0PREDICTED: putative Myb family transcription factor At1g14600 isoform X2
TrEMBLG7KSC81e-144G7KSC8_MEDTR; MYB-like transcription factor family protein
STRINGGLYMA18G43550.22e-94(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-47G2-like family protein